PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017966.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 175aa    MW: 19928.4 Da    PI: 6.6822
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017966.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.14.8e-14243748
                     HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
      Pbr017966.1  2 EEDLILINYIANHGEGVWNSLAKSAGLKRTGKSCRLRWLNYL 43
                     9***************************************97 PP

2Myb_DNA-binding568.8e-184992146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ T+eE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
      Pbr017966.1 49 RGNITPEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNYWRT 92
                     7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.632143IPR017930Myb domain
CDDcd001677.58E-9243No hitNo description
SuperFamilySSF466892.23E-26290IPR009057Homeodomain-like
PfamPF002498.0E-13243IPR001005SANT/Myb domain
SMARTSM007174.6E-5245IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-19250IPR009057Homeodomain-like
PROSITE profilePS5129425.8594498IPR017930Myb domain
SMARTSM007171.8E-154896IPR001005SANT/Myb domain
PfamPF002491.2E-164992IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-255197IPR009057Homeodomain-like
CDDcd001671.36E-125392No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MEEDLILINY IANHGEGVWN SLAKSAGLKR TGKSCRLRWL NYLRPDVRRG NITPEEQLLI  60
MELHAKWGNR WSKIAKHLPG RTDNEIKNYW RTRIQKHIKP AENITPGQSS EVNDQAITSQ  120
VSISNTVDTM DISHSAPTYQ ANMDAYPPPL PADQSNESYW SMEDLWSLQL LNGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2129813108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009375123.11e-127PREDICTED: myb-related protein 305-like
RefseqXP_009377203.11e-127PREDICTED: myb-related protein 305-like
SwissprotP813911e-85MYB05_ANTMA; Myb-related protein 305
TrEMBLM5XIW31e-107M5XIW3_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g01090.t013e-89(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33053469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40350.11e-83myb domain protein 24